PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G28230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 364aa    MW: 40057.3 Da    PI: 8.236
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G28230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.9e-071760339
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                     +r C+ + + +++++C  ++ +lC+ C  + H+        H+v
  OMERI03G28230.1 17 ARACDGCMRRRARWHCPADDAFLCQACDASVHSAnslarrhHRV 60
                     578*****************************667888886655 PP

2CCT66.57.6e-23270313144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk+a
  OMERI03G28230.1 270 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA 313
                      9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.5E-71562IPR000315B-box-type zinc finger
PROSITE profilePS501199.8261562IPR000315B-box-type zinc finger
PfamPF006432.5E-51759IPR000315B-box-type zinc finger
CDDcd000212.83E-111862No hitNo description
PROSITE profilePS5101715.993270312IPR010402CCT domain
PfamPF062039.9E-18270312IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MASAAAATGA ALGARTARAC DGCMRRRARW HCPADDAFLC QACDASVHSA NSLARRHHRV  60
RLPSASSSPG SSPRSAAAPQ DDEDLLYRVP VFDPMLAELY NPVSADDEEQ QIEQKPAARL  120
GPFSEPSPEF ASGSVEADGL SGFDVPDMEL ASFAADMESL LMGVDEGFDD LGFLDDEKPH  180
VKLDLDMDMD FASISPAPPP EREERKRKRP EMILKLDYEG VIDSWARDGA SPWFHGERPR  240
FDPGESWPDF PAGSRGGLGA AVTAVTGGER EARVSRYREK RRTRLFAKKI RYEVRKLNAE  300
KRPRMKGRFV KRAAALPPLP LPRHQHPPPQ PPRALPPVPM MLAPRAAHGR YRSRSASVAH  360
ARVV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1280296RRTRLFAKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1205630.0AK120563.1 Oryza sativa Japonica Group cDNA clone:J013132M18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628112.11e-163PREDICTED: zinc finger protein CONSTANS-LIKE 16
SwissprotQ8RWD01e-61COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0E0D5J10.0A0A0E0D5J1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013431-PA1e-163(Oryza sativa Indica Group)
STRINGLOC_Os03g50310.11e-163(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100042228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.16e-24B-box type zinc finger protein with CCT domain